DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and SLC25A27

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:326 Identity:122/326 - (37%)
Similarity:188/326 - (57%) Gaps:14/326 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEEPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQA-KKTG---KA 77
            |||.|..|.....|..::     ::.:...|.:||...||||:.|||:|:.||.| .:.|   :.
Human     5 EEEERLLPLTQRWPRASK-----FLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARE 64

  Fly    78 MPTFRA---TLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKI 139
            ...:|.   |...:|..|||..|:.|.:..:.|:.:::..|:|.|:..|.....::|  :|...:
Human    65 SAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSE--DEHYPL 127

  Fly   140 YMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKG 204
            :.::.....||.|.|.||||.|:|||:||.||:|:..|..:|...:..||..|...||:..:|.|
Human   128 WKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAG 192

  Fly   205 VGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMM 269
            ..|:..||.|:..||:.:||..|........||:.:....:||:|:||.||:|.|||||||||:|
Human   193 WVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIM 257

  Fly   270 NQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEGQSG 334
            |||.|:.|:.|.||:|.||:.:.|:.||.::||||.:|:|.|:.|:|::|||:.|::|:..|.|.
Human   258 NQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSP 322

  Fly   335 F 335
            |
Human   323 F 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/81 (32%)
Mito_carr 137..232 CDD:278578 35/94 (37%)
Mito_carr 237..329 CDD:278578 47/91 (52%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 28/102 (27%)
Solcar 1 21..115 28/98 (29%)
Mito_carr 125..219 CDD:365909 35/93 (38%)
Solcar 2 125..217 35/91 (38%)
Solcar 3 226..317 46/90 (51%)
Mito_carr 227..317 CDD:365909 46/89 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158856
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.