DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a14

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:322 Identity:106/322 - (32%)
Similarity:181/322 - (56%) Gaps:25/322 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLEIEEEPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAK---KT 74
            |.|:|:..:  .:.::..::..| ::.:|...:.:.:||...||:|:.|||:||.|:...   |.
  Rat    39 SAELEQHQK--SSALSHEMSGLN-WKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKE 100

  Fly    75 GKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKI 139
            .|....|.| |..:.|.||..:||:|.:..:.|...:.::::.:|...:|.|:.:.|  :|.|.|
  Rat   101 IKYRGMFHA-LFRIYREEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLE--DETLLI 162

  Fly   140 YMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKG 204
            .|.  |...:|.|:..:|||.|::|:|||.:|...|       .||:.:|:|||::.|...:|:|
  Rat   163 NMI--CGVVSGVISSTIANPTDVLKIRMQAQGSLFQ-------GSMIGSFIDIYQQEGTRGLWRG 218

  Fly   205 VGPSCMRACLMTTGDVGSYDISKRTFKRLL---DLEEGLPLRFVSSMCAGLTASVLSTPADVIKS 266
            |.|:..||.::...::..|||:|   |.|:   .|.:.:...||||...||..::.|.|.||:::
  Rat   219 VVPTAQRAAIVVGVELPVYDITK---KHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRT 280

  Fly   267 RMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            |||||.......:| ||.:||.:.|:.:.||...||||..|.|.||||::::|:::.|||::
  Rat   281 RMMNQRAIVGHVDL-YKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/77 (31%)
Mito_carr 137..232 CDD:278578 33/94 (35%)
Mito_carr 237..329 CDD:278578 37/92 (40%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 102/295 (35%)
Mito_carr 253..342 CDD:395101 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103926
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.