DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a27

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:302 Identity:119/302 - (39%)
Similarity:173/302 - (57%) Gaps:16/302 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FPPTNVADPLTAR----NLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQA-KKTGK-AMPT 80
            ||......|||.|    :.|.|   :...|.:||...||||:.|||:|:.||.| .|.|. ||.:
  Rat     3 FPEEESLQPLTQRWPRTSKFLL---SGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMES 64

  Fly    81 --FRA---TLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIY 140
              :|.   |...:::.|||..|:.|.:..:.|:.:::..|:|.|:..|.....::|  :|...::
  Rat    65 APYRGMMRTALGIVQEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSE--DEHYPLW 127

  Fly   141 MALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGV 205
            .::.....||.|.|.||||.|:|||:||.||:||..|..:|...:..||..|...||:..:|.|.
  Rat   128 KSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW 192

  Fly   206 GPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMN 270
            .|:..||.|:..||:.:||..|........||:.:....:||:|:||.||:|.|||||||||:||
  Rat   193 IPNIQRAALVNMGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMN 257

  Fly   271 QPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRL 312
            ||.|:.|:.|.||:|.|||.:.|:.||.|:||||.:|:|.|:
  Rat   258 QPRDKQGRGLLYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 28/81 (35%)
Mito_carr 137..232 CDD:278578 36/94 (38%)
Mito_carr 237..329 CDD:278578 42/76 (55%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 32/101 (32%)
Mito_carr 122..218 CDD:278578 37/95 (39%)
Mito_carr 224..311 CDD:278578 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.