DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and DIC1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:84/280 - (30%)
Similarity:140/280 - (50%) Gaps:31/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYD 120
            |||:||.|:|.       .....||....|.:::..||...||:|.||.|.|...:.::|...||
Yeast    33 PLDLAKVRLQA-------APMPKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYD 90

  Fly   121 VFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTE-----GRRRQLGYDV 180
            :.:...:    ..|::..:...|.||..:|.|.....|..|:|.:|||.:     .:||      
Yeast    91 LLKE
NVI----PREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRR------ 145

  Fly   181 RVNSMVQAFVDIYR-RGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLP-LR 243
            ...:.:.....||| .|||.:::.|..|:.:|..|||...|.:||:.|......||.:.... ..
Yeast   146 NYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKNYLVTKL
DFDASKNYTH 210

  Fly   244 FVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPT 308
            ..:|:.|||.|:.:.:||||:|:|:||...|       ::.:|..:...||:||...:::|.:|:
Yeast   211 LTASLLAGLVATTVCSPADVMKTRIMNGSGD-------HQPALKILADAVRKEGPSFMFRGWLPS 268

  Fly   309 WFRLGPFSVLFWLSVEQLRQ 328
            :.|||||::|.:.::|||::
Yeast   269 FTRLGPFTMLIFFAIEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/67 (33%)
Mito_carr 137..232 CDD:278578 29/100 (29%)
Mito_carr 237..329 CDD:278578 30/93 (32%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 22/67 (33%)
Mito_carr 100..200 CDD:395101 30/105 (29%)
Mito_carr 203..289 CDD:395101 30/93 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.