DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and ucp1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:310 Identity:106/310 - (34%)
Similarity:170/310 - (54%) Gaps:24/310 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKA-----MPTFRA 83
            |::|..|||.:.|     :....|.:|:...||||.||.|:|:.||:| .||.|     ...| .
Zfish     6 PSDVPPPLTVKVL-----SAGTAACIADLVTFPLDTAKVRLQIQGEKA-VTGAAKGIRYKGVF-G 63

  Fly    84 TLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFT 148
            |::.|:|.||.:|||.|..|.:.|...|.|:|:.|||..:.  .|...::...:.:.:..||  |
Zfish    64 TISTMMRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKS--FYTRGKDNPNVAVRILAGC--T 124

  Fly   149 AGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRAC 213
            .|.:|.::|.|.|:||||.|.:...:.:|.  |.|..:||:..|::..||..:|||..|:..|..
Zfish   125 TGAMAVSMAQPTDVVKVRFQAQMNLQGVGR--RYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNA 187

  Fly   214 LMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGK 278
            |:...::.|||:.|....:...|.:.||..|||:..||...:|:::|.||:|:|.||.|..:   
Zfish   188 LVNCTELVSYDLIKEAILKHRLLSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMNSPPGQ--- 249

  Fly   279 NLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
               |.:|.:|...::.:||....|||.:|::.|||.::|:.::|.|||::
Zfish   250 ---YSSSTNCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 33/79 (42%)
Mito_carr 137..232 CDD:278578 31/94 (33%)
Mito_carr 237..329 CDD:278578 33/92 (36%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 39/108 (36%)
Mito_carr 111..208 CDD:395101 31/100 (31%)
Mito_carr 213..299 CDD:395101 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.