DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and UCP2

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:296 Identity:90/296 - (30%)
Similarity:156/296 - (52%) Gaps:18/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YVNTFI----GANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFR---ATLTNMIRVEGFKSL 97
            ::.|||    .|..||.|..|||.||.|:|:..:.....|:.:|.:|   .||..:.|.||...|
plant    12 FLETFICSAFAACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGSIGTLATIAREEGISGL 76

  Fly    98 YAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDI 162
            :.|..|.:.|..|:..||:.||:..:...:..:...:  :.:|..:..:...|.||..:|||.|:
plant    77 WKGVIAGLHRQCIYGGLRIGLYEPVKTLLVGSDFIGD--IPLYQKILAALLTGAIAIIVANPTDL 139

  Fly   163 VKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISK 227
            ||||:|:|| :...|...|....|.|:..|.:..|:.::|.|:||:..|..::...::.|||..|
plant   140 VKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAELASYDQIK 203

  Fly   228 RTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKL 292
            .|..::....:.:....::.:.||..|..:.:|.||:|||||....        |:|::||..|.
plant   204 ETIMKIPFFRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMGDST--------YRNTVDCFIKT 260

  Fly   293 VREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            ::.||::..|||.:|.:.|||.::.:.:|::||:::
plant   261 MKTEGIMAFYKGFLPNFTRLGTWNAIMFLTLEQVKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 27/77 (35%)
Mito_carr 137..232 CDD:278578 31/94 (33%)
Mito_carr 237..329 CDD:278578 28/92 (30%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 90/294 (31%)
Mito_carr 212..300 CDD:395101 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.