DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and DIC3

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_196509.1 Gene:DIC3 / 830806 AraportID:AT5G09470 Length:337 Species:Arabidopsis thaliana


Alignment Length:348 Identity:103/348 - (29%)
Similarity:160/348 - (45%) Gaps:78/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQ------------------------------- 70
            |:.::...|.|.:|.:...|||:.|.|||:.||.                               
plant     3 FKPFLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDS 67

  Fly    71 ---------------AKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYD 120
                           :..|...|..| |...::::.||..:|::|.||.:.|..::::.|:.:||
plant    68 LIGSISLLPLHIHAPSSSTRSVMTPF-AVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYD 131

  Fly   121 VFRRPFLYQNERN-EEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEG-----RRRQLGYD 179
            ..:|.:..|...| ..|.||...|    .||.:...:.||.|:..||||.:|     |||     
plant   132 FLKRRWTDQLTGNFPLVTKITAGL----IAGAVGSVVGNPADVAMVRMQADGSLPLNRRR----- 187

  Fly   180 VRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLL-----DLEEG 239
             ...|:|.|...|.|:.|:.|:|:|...:..||.::|...:.:||    ..|.:|     ....|
plant   188 -NYKSVVDAIDRIARQEGVSSLWRGSWLTVNRAMIVTASQLATYD----HVKEILVAGGRGTPGG 247

  Fly   240 LPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKG 304
            :.....:|..||:.|:|.|.|.||:|:||||     :.|.: |...|||..|:|.|||.:.||||
plant   248 IGTHVAASFAAGIVAAVASNPIDVVKTRMMN-----ADKEI-YGGPLDCAVKMVAEEGPMALYKG 306

  Fly   305 LMPTWFRLGPFSVLFWLSVEQLR 327
            |:||..|.|||:::.:|::||:|
plant   307 LVPTATRQGPFTMILFLTLEQVR 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/120 (20%)
Mito_carr 137..232 CDD:278578 30/99 (30%)
Mito_carr 237..329 CDD:278578 40/91 (44%)
DIC3NP_196509.1 Mito_carr <19..139 CDD:395101 24/120 (20%)
Mito_carr 143..238 CDD:395101 33/108 (31%)
Mito_carr 251..336 CDD:395101 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.