DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and DIC2

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:319 Identity:99/319 - (31%)
Similarity:153/319 - (47%) Gaps:46/319 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKT-------GKAMP-----TFRATLT------ 86
            :|...|.:.:|.....|||:.|.|:|:.||....|       ..|.|     .|..|.:      
plant     6 FVEGGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPKVG 70

  Fly    87 ------NMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGC 145
                  |:::.||..:|::|.||.:.|..::::.|:.||:|.:..:   .:.....|.:...:|.
plant    71 PISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKW---TDPESGKLNLSRKIGA 132

  Fly   146 SFTAGCIAQALANPFDIVKVRMQTEG------RRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKG 204
            ...||.|..|:.||.|:..||||.:|      ||...|....:.|||:.       .|:.|:|:|
plant   133 GLVAGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKG-------EGVTSLWRG 190

  Fly   205 VGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMM 269
            ...:..||.::|...:.|||..|........:.:||....|:|..||..|||.|.|.||||:|:|
plant   191 SALTINRAMIVTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVM 255

  Fly   270 NQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            |..|..      |..:.||..|.|:.||.:.||||.:||..|.|||:|:.::::||:|:
plant   256 NMKVGA------YDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVRK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/98 (27%)
Mito_carr 137..232 CDD:278578 31/100 (31%)
Mito_carr 237..329 CDD:278578 40/92 (43%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 28/114 (25%)
Mito_carr 122..220 CDD:395101 31/104 (30%)
Mito_carr 225..312 CDD:395101 40/90 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.