DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and PUMP1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:286 Identity:87/286 - (30%)
Similarity:154/286 - (53%) Gaps:14/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFR---ATLTNMIRVEGFKSLYAGFSAMVTRN 108
            |.:.|.|..|||.||.|:|:. :.|......:|.:|   .|:..:.|.||.:||:.|....:.|.
plant    22 ACVGEVCTIPLDTAKVRLQLQ-KSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVVPGLHRQ 85

  Fly   109 FIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRR 173
            .:|..||:.:|:..:..::.::...:..|...:..|  .|.|.:...:|||.|:||||:|.|| :
plant    86 CLFGGLRIGMYEPVKNLYVGKDFVGDVPLSKKILAG--LTTGALGIMVANPTDLVKVRLQAEG-K 147

  Fly   174 RQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEE 238
            ...|...|.:..:.|:..|.|:.|:.::|.|:||:..|..::...::.|||..|.|..::....:
plant   148 LAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKETILKIPGFTD 212

  Fly   239 GLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYK 303
            .:....:|.:.||..|..:.:|.||:|||||.    :||.   ||.::||..|.::.:|.:..||
plant   213 NVVTHILSGLGAGFFAVCIGSPVDVVKSRMMG----DSGA---YKGTIDCFVKTLKSDGPMAFYK 270

  Fly   304 GLMPTWFRLGPFSVLFWLSVEQLRQW 329
            |.:|.:.|||.::|:.:|::||.:::
plant   271 GFIPNFGRLGSWNVIMFLTLEQAKKY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/77 (31%)
Mito_carr 137..232 CDD:278578 31/94 (33%)
Mito_carr 237..329 CDD:278578 31/91 (34%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 25/84 (30%)
Mito_carr 110..206 CDD:395101 31/98 (32%)
Mito_carr 210..299 CDD:395101 31/94 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.