DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and PNC1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_566251.1 Gene:PNC1 / 819693 AraportID:AT3G05290 Length:322 Species:Arabidopsis thaliana


Alignment Length:298 Identity:70/298 - (23%)
Similarity:109/298 - (36%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IGANLAESCVFPLDVAKTRMQVD----GEQ-----------AKKTGKAMPTFRATLTNMIRVEGF 94
            ||:.|:.:.::|||..|::.|.:    |:|           |...|:..                
plant    16 IGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISKGQVF---------------- 64

  Fly    95 KSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANP 159
             |||.|......::||...:....|..|:|  ::......:.:.....|..:..||.....|..|
plant    65 -SLYQGLGTKNFQSFISQFIYFYSYSYFKR--VHSERTGSKSIGTKANLLIAAAAGACTSVLIQP 126

  Fly   160 FDIVKVRMQTE--GRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGS 222
            .|....||||.  |..:.|...:...|...||             .|:|.|    .|:|:.....
plant   127 LDTASSRMQTSEFGESKGLWKTLTEGSWADAF-------------DGLGIS----LLLTSNPAIQ 174

  Fly   223 YDISKRTFKRLL-----DLEEGLP-------LRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDE 275
            |.:..:..:.||     ..|.|..       :.||....:...|:||:.||  |:.::|.|..||
plant   175 YTVFDQLKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPA--IRCKVMIQAADE 237

  Fly   276 SGKNLYYKNSLDCVRKLV--------REEGVLTLYKGL 305
            |.:| ..|......||.:        |:||:|..:|||
plant   238 SKEN-ETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 18/89 (20%)
Mito_carr 137..232 CDD:278578 21/96 (22%)
Mito_carr 237..329 CDD:278578 26/84 (31%)
PNC1NP_566251.1 Mito_carr 4..94 CDD:395101 21/96 (22%)
Mito_carr 108..189 CDD:395101 23/97 (24%)
Mito_carr 202..295 CDD:395101 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.