DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and UCP5

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:305 Identity:101/305 - (33%)
Similarity:160/305 - (52%) Gaps:33/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ANLAESC-VFPLDVAKTRMQVDGEQAKKTGKAMP--TFRATLT---------------NMIRVEG 93
            |::...| ..|||:.|.|||:.||.|.......|  .|:.:.|               .:||.||
plant    12 ASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGVGSRLIREEG 76

  Fly    94 FKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALAN 158
            .::|::|.||.|.|..::::.|:.|||:.:..:   .:...:.:.:...:|....||.|..|:.|
plant    77 MRALFSGVSATVLRQTLYSTTRMGLYDIIKGEW---TDPETKTMPLMKKIGAGAIAGAIGAAVGN 138

  Fly   159 PFDIVKVRMQTEGR-----RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTG 218
            |.|:..||||.:||     ||      ...|::.|...:.|..|:.|:|:|...:..||.|:|:.
plant   139 PADVAMVRMQADGRLPLTDRR------NYKSVLDAITQMIRGEGVTSLWRGSSLTINRAMLVTSS 197

  Fly   219 DVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYK 283
            .:.|||..|.|......|::||.....:|..||..|||.|.|.||||:|:||..| .:|....||
plant   198 QLASYDSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKV-VAGVAPPYK 261

  Fly   284 NSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            .::||..|.|:.||:::||||.:||..|..||:|:.::::||:::
plant   262 GAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 28/92 (30%)
Mito_carr 137..232 CDD:278578 32/99 (32%)
Mito_carr 237..329 CDD:278578 39/92 (42%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 29/93 (31%)
Mito_carr <136..213 CDD:395101 27/82 (33%)
Mito_carr 216..311 CDD:395101 39/92 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.