DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and ucp3

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:302 Identity:99/302 - (32%)
Similarity:159/302 - (52%) Gaps:27/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FIGAN----LAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFR---ATLTNMIRVEGFKSLYAGF 101
            |.||.    .|:...||||.||.|:|:.||.....|.|:..:|   .|:|.|:|.||.:|||.|.
Zfish    17 FFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTMVRTEGARSLYNGL 81

  Fly   102 SAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVR 166
            .|.:.|...|.|:|:.|||..:: |..:...|..::...:| ||  |.|.:|.|.|.|.|:||||
Zfish    82 VAGLQRQMSFASVRIGLYDSMKQ-FYTRGSENASIVTRLLA-GC--TTGAMAVAFAQPTDVVKVR 142

  Fly   167 MQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFK 231
            .|.:.|....|  .|.|..:.|:..|.|..|:..:|||..|:..|..::...::.:|||.|....
Zfish   143 FQAQVRHTDGG--KRYNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYDIIKDLIL 205

  Fly   232 RLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREE 296
            :...:.:.||..|.::..||...:::::|.||:|:|.||....:      |.::|:|...::.:|
Zfish   206 KYDLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSAGQ------YGSALNCALMMLTKE 264

  Fly   297 GVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ--------WE 330
            |....|||.||::.|||.::::.::|.||:::        ||
Zfish   265 GPAAFYKGFMPSFLRLGSWNIVMFVSYEQIKRCMTRMQHSWE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 32/77 (42%)
Mito_carr 137..232 CDD:278578 32/94 (34%)
Mito_carr 237..329 CDD:278578 28/99 (28%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 36/93 (39%)
PTZ00169 14..298 CDD:240302 97/292 (33%)
Mito_carr 114..207 CDD:278578 32/97 (33%)
Mito_carr 211..301 CDD:278578 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.