DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a27

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:265 Identity:103/265 - (38%)
Similarity:156/265 - (58%) Gaps:9/265 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FPLDVAKTRMQVDGEQA-KKTGKA---MPTFRA---TLTNMIRVEGFKSLYAGFSAMVTRNFIFN 112
            ||||:.|||:|:.||.| .:.|..   ...:|.   |...:::.|||..|:.|.:..:.|:.:::
Mouse    51 FPLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVYS 115

  Fly   113 SLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLG 177
            ..|:|.|:..|.....::|  ::...::.::.....||.|.|.||||.|:|||:||.||:||..|
Mouse   116 GGRMVTYEHLREVVFG
KSE--DKHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEG 178

  Fly   178 YDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPL 242
            ..:|...:..||..|...||:..:|.|..|:..||.|:..||:.:||..|........||:.:..
Mouse   179 KPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLV
LNTPLEDNIST 243

  Fly   243 RFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMP 307
            ..:||:|:||.||:|.|||||||||:||||.|:.|:.|.||:|.||:.:.|:.||.|:||||.:|
Mouse   244 HGLSSLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSADCLIQAVQGEGFLSLYKGFLP 308

  Fly   308 TWFRL 312
            :|.|:
Mouse   309 SWLRM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 23/75 (31%)
Mito_carr 137..232 CDD:278578 36/94 (38%)
Mito_carr 237..329 CDD:278578 41/76 (54%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 24/79 (30%)
Mito_carr 138..232 CDD:365909 36/93 (39%)
Mito_carr 240..>314 CDD:365909 40/74 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.810

Return to query results.
Submit another query.