DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and UCP2

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:283 Identity:88/283 - (31%)
Similarity:144/283 - (50%) Gaps:21/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESCVFPLDVAKTRMQVDGE-QAKKTGKAMPTFR---ATLTNMIRVEGFKSLYAGFSAMVTRNFI 110
            |..|.:|:    ..:|:.|| |......|...:|   .|:..|:|.||.:|||.|..|.:.|...
Human    32 AYPCSYPV----LALQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMS 92

  Fly   111 FNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQ 175
            |.|:|:.|||..::.:    .:..|...|...|....|.|.:|.|:|.|.|:||||.|.:.|   
Human    93 FASVRIGLYDSVKQFY----TKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR--- 150

  Fly   176 LGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGL 240
            .|...|..|.|.|:..|.|..|...:|||..|:..|..::...::.:||:.|....:...:.:.|
Human   151 AGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDL 215

  Fly   241 PLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGL 305
            |..|.|:..||...:|:::|.||:|:|.||..:.:      |.::..|...::::||....|||.
Human   216 PCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQ------YSSAGHCALTMLQKEGPRAFYKGF 274

  Fly   306 MPTWFRLGPFSVLFWLSVEQLRQ 328
            ||::.|||.::|:.:::.|||::
Human   275 MPSFLRLGSWNVVMFVTYEQLKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/77 (34%)
Mito_carr 137..232 CDD:278578 31/94 (33%)
Mito_carr 237..329 CDD:278578 30/92 (33%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 23/73 (32%)
Mito_carr 113..207 CDD:278578 32/96 (33%)
Mito_carr 218..300 CDD:278578 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.