DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and UCP1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:305 Identity:98/305 - (32%)
Similarity:156/305 - (51%) Gaps:21/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LTARNL-----FQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIR 90
            |||.::     .||: :..|.|.||:...||||.||.|:||.||....:.........|:|.:::
Human     4 LTASDVHPTLGVQLF-SAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVK 67

  Fly    91 VEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVL--KIYMALGCSFTAGCIA 153
            .||...||:|..|.:.|.....|||:.|||..:. ||...:.....|  ||...|    |.|.:|
Human    68 TEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQE-FLTAGKETAPSLGSKILAGL----TTGGVA 127

  Fly   154 QALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTG 218
            ..:..|.::||||:|.:....  |...|......|:..|....||..:|||..|:.||:.::...
Human   128 VFIGQPTEVVKVRLQAQSHLH--GIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCT 190

  Fly   219 DVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYK 283
            ::.:||:.|..|.:...|.:.:|...||::.||..|:.:|:|.||:|:|.:|.|..:      ||
Human   191 ELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQ------YK 249

  Fly   284 NSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            :..:|..|:...||....:|||:|::.|||.::|:.::..|||::
Human   250 SVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 28/74 (38%)
Mito_carr 137..232 CDD:278578 29/96 (30%)
Mito_carr 237..329 CDD:278578 31/92 (34%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 33/95 (35%)
Solcar 1 11..102 32/92 (35%)
Mito_carr 111..206 CDD:278578 29/100 (29%)
Solcar 2 111..201 28/95 (29%)
Solcar 3 210..295 31/91 (34%)
Mito_carr 215..300 CDD:278578 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.