DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a35

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_082324.1 Gene:Slc25a35 / 71998 MGIID:1919248 Length:300 Species:Mus musculus


Alignment Length:303 Identity:86/303 - (28%)
Similarity:144/303 - (47%) Gaps:34/303 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GANLAESCVF--PLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMI-------RVEGFKSLYAGF 101
            |.....:|||  ||:|.|||||:.||.     :|..|::....|:.       :|:|..:|..|.
Mouse     7 GVAACGACVFTNPLEVVKTRMQLQGEL-----QAPGTYQRHYRNVFHAFFTIGKVDGLAALQKGL 66

  Fly   102 SAMVTRNFIFNSLRVVLYDVFR-RPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKV 165
            ...:...|:.|.:|:..|.:.. |.:|:.||.....::   :......||.:...|.:|..:||.
Mouse    67 GPALLYQFLMNGIRLGTYGLAESRGYLHTNEGTHSPVR---SAAAGALAGVMGAYLGSPIYMVKT 128

  Fly   166 RMQTEGRRR-QLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRT 229
            .:|.:.... .:|:..:...|.||..:|.::.||..:|:|......|..:.::..:.::.    :
Mouse   129 HLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPRVVIGSSTQLCTFS----S 189

  Fly   230 FKRLLDLEEGLP-----LRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCV 289
            .|.||...|..|     :...::|.:|:...|..||.||..:|:.|||.|..||.|.|:..||.:
Mouse   190 IKDLLSQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTDTRGKGLMYRGILDAL 254

  Fly   290 RKLVREEGVLTLYKGLMPTWFRLGPFSVL---FWLSVEQLRQW 329
            .:..|.||...:|||:..::|||||.::|   ||   :|||.:
Mouse   255 LQTARTEGFFGMYKGIGASYFRLGPHTILSLFFW---DQLRSF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/84 (29%)
Mito_carr 137..232 CDD:278578 17/95 (18%)
Mito_carr 237..329 CDD:278578 37/99 (37%)
Slc25a35NP_082324.1 Solcar 1 1..90 25/87 (29%)
Mito_carr 2..84 CDD:365909 24/81 (30%)
Solcar 2 100..193 18/99 (18%)
Mito_carr 101..194 CDD:365909 18/99 (18%)
Solcar 3 203..294 35/93 (38%)
Mito_carr 209..297 CDD:365909 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.