DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a11

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:331 Identity:102/331 - (30%)
Similarity:168/331 - (50%) Gaps:55/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IEEEPRFPPTNVADPLTARNLFQLYVNTFIGANLA--ESCVF--PLDVAKTRMQVDGEQAKKTGK 76
            ::.:||..|.:|               .|:...||  .:.||  |||:.|.|||:.||.| ||.:
  Rat    12 MDGKPRTSPKSV---------------KFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGA-KTRE 60

  Fly    77 AMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEE------ 135
            ...:|.| ||::::.||.:.:|.|.||.:.|...:.:.|:.:|.|     |::.....:      
  Rat    61 YKTSFHA-LTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTV-----LFERLTGADGTPPGF 119

  Fly   136 VLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGR-----RRQLGYDVRVNSMVQAFVDIYRR 195
            :||..:.:    |||.....:..|.::..:||..:||     ||  ||    .::..|.:.|.|.
  Rat   120 LLKALIGM----TAGATGAFVGTPAEVALIRMTADGRLPADQRR--GY----KNVFNALIRIARE 174

  Fly   196 GGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLD---LEEGLPLRFVSSMCAGLTASVL 257
            .|:|::|:|..|:..||.::....:.||..||:.   |||   ..:.:...|.:||.:||..:..
  Rat   175 EGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQF---LLDSGYFSDNILCHFCASMISGLVTTAA 236

  Fly   258 STPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLS 322
            |.|.|::|:|:.|..:.: ||. .|||.||.:.|:||.||..:|:||..|.:.||||.:||.::.
  Rat   237 SMPVDIVKTRIQNMRMID-GKP-EYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIF 299

  Fly   323 VEQLRQ 328
            :||:.:
  Rat   300 LEQMNK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 30/78 (38%)
Mito_carr 137..232 CDD:278578 28/99 (28%)
Mito_carr 237..329 CDD:278578 35/92 (38%)
Slc25a11NP_071793.2 Solcar 1 23..108 33/106 (31%)
Mito_carr 24..102 CDD:395101 29/79 (37%)
Mito_carr 116..213 CDD:395101 31/109 (28%)
Solcar 2 117..208 28/100 (28%)
Mito_carr 215..313 CDD:395101 35/93 (38%)
Solcar 3 217..306 35/91 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.