DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and slc25a27

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001011241.1 Gene:slc25a27 / 496683 XenbaseID:XB-GENE-1005902 Length:319 Species:Xenopus tropicalis


Alignment Length:313 Identity:121/313 - (38%)
Similarity:190/313 - (60%) Gaps:15/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKK----TGKAMPTFRA---TLTN 87
            |.|::     ::.:...|::||...||||:.|||:|:.||.|.|    .|.|:| :|.   |.|.
 Frog    15 PRTSK-----FILSACAASVAELVTFPLDLTKTRLQIQGEAALKRHGEVGSAVP-YRGMVRTATG 73

  Fly    88 MIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCI 152
            :::.||...|:.|.:..|.|:.:::.:|:|.|:..|...|  .:.:.:...::.::....|||.|
 Frog    74 IVQEEGLLKLWQGATPAVYRHIVYSGVRMVAYEHIRDSVL--GKGDGDTFPLWKSVVGGMTAGAI 136

  Fly   153 AQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTT 217
            .|..|:|.|:|||:||.||:||..|...||..:..|||.|..:||:..:|.|..|:..||.|:..
 Frog   137 GQFFASPTDLVKVQMQMEGKRRLEGKPPRVRGVYHAFVTIVSKGGIRGLWAGWVPNVQRAALVNM 201

  Fly   218 GDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYY 282
            ||:.:||:.|....|...:::......:||:|:|:.|:.|.|||||||:|:||||.|:.|:.|.|
 Frog   202 GDLTTYDMVKHFLLRNTPIKDNSLCHTISSICSGVVAATLGTPADVIKTRIMNQPRDKHGRGLLY 266

  Fly   283 KNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEGQSGF 335
            |:|.||:.:.:|.||.::||||.||||.|:.|:|::|||:.||:|:..|.|.|
 Frog   267 KSSTDCLIQAIRGEGFMSLYKGFMPTWMRMAPWSLVFWLTYEQIRRLGGVSSF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 29/81 (36%)
Mito_carr 137..232 CDD:278578 37/94 (39%)
Mito_carr 237..329 CDD:278578 46/91 (51%)
slc25a27NP_001011241.1 Mito_carr 18..114 CDD:365909 32/103 (31%)
Mito_carr 122..216 CDD:365909 37/93 (40%)
Mito_carr 223..313 CDD:365909 46/89 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.