DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Dic1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:286 Identity:78/286 - (27%)
Similarity:132/286 - (46%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNF 109
            :||.:.   ..|||:.|..:|        |.:...:....:..:.|.:|....|.|.||.|.|..
  Fly    18 VGAAMV---THPLDLIKVTLQ--------TQQGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQL 71

  Fly   110 IFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGR-- 172
            .:::.|..:|:..::   |.| .:....|:.:| |.|   |.:...:..|.|:|.||||.:.:  
  Fly    72 TYSTARFGVYEAGKK---YVN-TDSFGGKVALA-GAS---GLVGGIVGTPADMVNVRMQNDVKLP 128

  Fly   173 -RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDL 236
             :::..|    |:.....|.:||:.|...::.|...:..|..|||.|.:..||.:|.........
  Fly   129 PQQRRNY----NNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYF 189

  Fly   237 EEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTL 301
            ::.|...|.:|:.||..|:.|:.|.||:|:|.||....|.       |.|..:.|...:.|.|..
  Fly   190 QDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF-------NGLWDIVKHTAKLGPLGF 247

  Fly   302 YKGLMPTWFRLGPFSVLFWLSVEQLR 327
            :||.:|.:.||||.:::.::.:||||
  Fly   248 FKGYVPAFVRLGPHTIITFVFLEQLR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 16/74 (22%)
Mito_carr 137..232 CDD:278578 27/97 (28%)
Mito_carr 237..329 CDD:278578 31/91 (34%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 20/88 (23%)
PTZ00169 13..273 CDD:240302 76/284 (27%)
Mito_carr 89..184 CDD:278578 28/103 (27%)
Mito_carr 189..278 CDD:278578 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.