DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and slc25a11

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:312 Identity:92/312 - (29%)
Similarity:155/312 - (49%) Gaps:25/312 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIR 90
            :.|.|.|:....:.......|.. |...|.|||:.|.|||:.| |..|..:...:|.| :.:::|
Zfish     6 DTAKPKTSPKSIKFLFGGLAGMG-ATVFVQPLDLVKNRMQLSG-QGSKAREYKTSFHA-VGSILR 67

  Fly    91 VEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQA 155
            .||.:.:|.|.||.:.|...:.:.|:.:|.:.   |...::.:......:|......|||.....
Zfish    68 NEGVRGIYTGLSAGLLRQATYTTTRLGIYTIL---FERMSKADGTPPNFFMKALIGMTAGATGAF 129

  Fly   156 LANPFDIVKVRMQTEGR-----RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLM 215
            :..|.::..:||..:||     ||  ||    .::..|.|.|.|..|:.::|:|..|:..||.::
Zfish   130 VGTPAEVALIRMTADGRLPPDQRR--GY----TNVFNALVRITREEGVTTLWRGCIPTMARAVVV 188

  Fly   216 TTGDVGSYDISKRTFKRLLD---LEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESG 277
            ....:.||..||:.   |||   ..:.:...|.:||.:||..:..|.|.|::|:|:.|..:.: |
Zfish   189 NAAQLASYSQSKQA---LLDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMID-G 249

  Fly   278 KNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQW 329
            |. .|.|.||.:.|::|.||..:|:||..|.:.||||.:||.::.:||:.::
Zfish   250 KP-EYNNGLDVLVKVIRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/74 (32%)
Mito_carr 137..232 CDD:278578 27/99 (27%)
Mito_carr 237..329 CDD:278578 33/91 (36%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 24/80 (30%)
PTZ00169 19..300 CDD:240302 89/297 (30%)
Mito_carr 110..207 CDD:278578 30/105 (29%)
Mito_carr 213..305 CDD:278578 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.