DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Tpc1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:323 Identity:76/323 - (23%)
Similarity:137/323 - (42%) Gaps:44/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVD----GEQAKKTGKAMPTFRAT-----LTN 87
            |...|.|:.... :.|.:..|...||||.|.|.|:.    |:.|.|.|....|.:.|     :..
  Fly    25 TREQLHQMLAGG-LSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKT 88

  Fly    88 MIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVF-----RRPFLYQNERNEEVLKIYMALGCSF 147
            :.|.||..:.:.|.:.....:.::...:...|:..     :..:|..::.....|       |..
  Fly    89 IYREEGMLAFWKGHNPAQVLSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFL-------CGA 146

  Fly   148 TAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRA 212
            .||..|..::.|.|:::.|:..:...:  ||    .:..:|...|.|:.|...|::|:.    .|
  Fly   147 AAGGAAVIISTPLDVIRTRLIAQDTSK--GY----RNATRAVSAIVRQEGPRGMYRGLS----SA 201

  Fly   213 CLMTTGDVGSYDISKRTFK----RLLDLEEGLPLRFVSSMCAGLTASVLST----PADVIKSRMM 269
            .|..|..:|:..::.|.|.    ..|::.:...|...:.:..|.::.:||.    |.|:||.|:.
  Fly   202 LLQITPLMGTNFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQ 266

  Fly   270 NQPVDES----GKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            .|..:.:    |:.|......||:|..||:|||..||||:.||..:....:.|::...::|:|
  Fly   267 IQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 19/88 (22%)
Mito_carr 137..232 CDD:278578 22/98 (22%)
Mito_carr 237..329 CDD:278578 29/100 (29%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 22/94 (23%)
PTZ00169 33..329 CDD:240302 72/313 (23%)
Mito_carr 153..222 CDD:278578 17/78 (22%)
Mito_carr 233..328 CDD:278578 27/94 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.