DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG16736

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:311 Identity:67/311 - (21%)
Similarity:108/311 - (34%) Gaps:81/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSLYAG 100
            :||...| ...|:....|:::.:..||.:         .:...|.::.:|.|:   .|....|.|
  Fly     3 VYVGLLI-KTTAQLLSHPMELVRVNMQAN---------VIHHSRLSINHMFRLMARHGLPGFYYG 57

  Fly   101 FSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIY-----MALGCS-FTAGCIAQALANP 159
            ..|.        .||..::.:......|..:.|:.||.:.     |.||.: |..|    .||.|
  Fly    58 IVAA--------CLRCTVHTMSTYTLFYNLQDNKYVLMLQPYNTSMVLGITGFWGG----VLATP 110

  Fly   160 FDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRA-----CLMTTGD 219
            |..:.|..|.:..|..                 |.|....:.|:|:  .||.|     .|.|...
  Fly   111 FAKLAVIRQADLTRGS-----------------YERRNYRNFWRGL--KCMYAKGGFTYLFTGWK 156

  Fly   220 VGSYD----------ISKRT------FKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRM 268
            :.|..          ||.:.      |.|   |:|......::....|...:|:.||.|.:.:..
  Fly   157 INSISSTAVAVLYTPISDKVHTVISWFHR---LDEPWLSDLITMALTGSIITVIMTPVDALATLT 218

  Fly   269 MNQPVDESGKNLY-YKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVL 318
            :|:. ...|:..| |     ..||::|:.|....:.|..|....|.|.:||
  Fly   219 LNES-SHYGRTSYPY-----LYRKIIRKHGYKGFFFGWKPALMALIPHTVL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 13/77 (17%)
Mito_carr 137..232 CDD:278578 26/121 (21%)
Mito_carr 237..329 CDD:278578 20/83 (24%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 15/92 (16%)
Mito_carr 187..277 CDD:278578 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.