DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG2616

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:344 Identity:74/344 - (21%)
Similarity:133/344 - (38%) Gaps:75/344 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKK-----------------T 74
            ::||.......|..::...||.:....:.||||.|||||.....|.|                 .
  Fly    81 LSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPN 145

  Fly    75 GKAMPTFRA---------TLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFL--Y 128
            |..:.:.|.         .|..:.|.||..:|::|....:........:..|.|:.|:..:|  |
  Fly   146 GSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIY 210

  Fly   129 QNERN-------------EEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDV 180
            ::..|             ::.|...:.:....||...|..:.:|.::|:.:||.:   ||     
  Fly   211 ESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---RQ----- 267

  Fly   181 RVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDV---GSYDISKRTFKRLL--DLEEGL 240
            ....|:|....:....|:..:|:|:.|:.:|       ||   |.|.....:.|:.|  ..:...
  Fly   268 TYAQMLQFVRSVVALQGVWGLWRGLRPTILR-------DVPFSGIYWPIYESLKQNLGHGSQPSF 325

  Fly   241 PLRFVSSMCAGLTASVLSTPADVIKSR----------MMNQPVDESGKNLYYKNSLDCVRKLVRE 295
            .|.|::.:.||..|::::||.||:|:.          ..:.|..:.||    |::...:..:.|.
  Fly   326 SLSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTDSPARDFGK----KSTFSRLTGIYRT 386

  Fly   296 EGVLTLYKGLMPTWFRLGP 314
            .||..|:.|..|...::.|
  Fly   387 HGVRGLFAGCGPRLLKVAP 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/100 (22%)
Mito_carr 137..232 CDD:278578 21/97 (22%)
Mito_carr 237..329 CDD:278578 21/88 (24%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 25/120 (21%)
Mito_carr 230..321 CDD:278578 23/105 (22%)
Mito_carr 321..425 CDD:278578 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.