DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Dic4

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:138/283 - (48%) Gaps:28/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESC----VFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFI 110
            |..|    |.|:|:.||.||:..::....|        |:..:..::|:...|.||||.:.|...
  Fly    29 ASMCVAFAVAPIDIVKTHMQIQRQKRSILG--------TVKRIHSLKGYLGFYDGFSAAILRQMT 85

  Fly   111 FNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQ 175
            ..::..::||..::  :...:|:..:.||  .|||  .||....|...|.|::.|||||:  .::
  Fly    86 STNIHFIVYDTGKK--MEYVDRDSYLGKI--ILGC--VAGACGSAFGIPTDLINVRMQTD--MKE 142

  Fly   176 LGYDVR-VNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEG 239
            ..|..| ...:....:.|.:..|..:::||...:..::.|.|...:..|||.|...::.:.:.:|
  Fly   143 PPYKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDG 207

  Fly   240 LPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKG 304
            |||.|::|:...:.:|.::.|.||:::.|||....|.  ...::.|:..:|     .||:..|:|
  Fly   208 LPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEF--RTVFQASVHMMR-----FGVMGPYRG 265

  Fly   305 LMPTWFRLGPFSVLFWLSVEQLR 327
            .:||..|..|.:.|.::..||||
  Fly   266 FVPTIVRKAPATTLLFVLYEQLR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 20/77 (26%)
Mito_carr 137..232 CDD:278578 27/95 (28%)
Mito_carr 237..329 CDD:278578 29/91 (32%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 75/281 (27%)
Mito_carr 26..100 CDD:278578 20/80 (25%)
Mito_carr 104..201 CDD:278578 28/102 (27%)
Mito_carr 211..292 CDD:278578 25/85 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441648
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.