DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG6893

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001369058.1 Gene:CG6893 / 40038 FlyBaseID:FBgn0036807 Length:291 Species:Drosophila melanogaster


Alignment Length:292 Identity:75/292 - (25%)
Similarity:131/292 - (44%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNF 109
            :...:|:....|.|:.:.||.|   ..|..|.|     :.|...||..||.|||.|.||.:.|..
  Fly    23 VAGAIAQCFTAPFDLIEARMVV---IKKDRGMA-----SNLQQAIRTHGFISLYDGLSAQLLRQL 79

  Fly   110 IFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRR 174
            .:.|:|..||::.:       |..::...:...:..:..|||:|..:..|.:::..|||.   .|
  Fly    80 TYTSMRFHLYEMGK-------EHLDDPAGLLDKVLVAALAGCVAGVVGTPMELINTRMQV---NR 134

  Fly   175 QLGYDVRVN--SMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLE 237
            .|..:.|.|  ::......:.|..|...::.|...|.||:.|:|.....:||.:|:.:.....::
  Fly   135 ALPKETRWNYRNVFDGLYRVTREEGFTKLYSGCFLSFMRSSLITISQNAAYDQAKQIYAEFFHMK 199

  Fly   238 -EGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTL 301
             :...|..:||    :||:.:..|  :||      |::    ||.|...:|. |:|:.....:..
  Fly   200 HDNTLLHLISS----VTAAFVCGP--IIK------PIE----NLRYLRMVDS-RRLINSISYMMR 247

  Fly   302 ------YKGLMPTWFRLGPFSVLFWLSVEQLR 327
                  ::|::|...|:.|.:|:.:||.||||
  Fly   248 FGSRGPFRGMVPYVLRMVPNTVITFLSFEQLR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 25/74 (34%)
Mito_carr 137..232 CDD:278578 23/96 (24%)
Mito_carr 237..329 CDD:278578 26/98 (27%)
CG6893NP_001369058.1 Mito_carr 20..96 CDD:395101 26/87 (30%)
Mito_carr 98..192 CDD:395101 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.