DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and slc25a10b

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_957466.1 Gene:slc25a10b / 394147 ZFINID:ZDB-GENE-040426-1095 Length:286 Species:Danio rerio


Alignment Length:295 Identity:81/295 - (27%)
Similarity:137/295 - (46%) Gaps:45/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESCVFPLDVAKTRMQVDGE-QAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNS 113
            |..|..|||:.|..:|...| :.:..|.|:        ::::.:||.:||:|.||.:.|...::.
Zfish    19 AACCTHPLDLIKVHLQTQQEVKMRMMGMAI--------HVVKNDGFLALYSGLSASLCRQMSYSL 75

  Fly   114 LRVVLYDVFR----------RPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQ 168
            .|..:|:..|          .|| ||        |:.:.....||.|.|    ..|.|:|.||||
Zfish    76 TRFAIYETVRDTLGSGSQGPMPF-YQ--------KVLLGAFGGFTGGFI----GTPADMVNVRMQ 127

  Fly   169 TEGRRRQLGYDVRVN--SMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFK 231
            .:.:   |..:.|.|  ..:.....::|..|...::.|...:..|..|:|.|.:..||.:|:...
Zfish   128 NDVK---LPLEQRRNYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAKQLVL 189

  Fly   232 RLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREE 296
            ....:.:.:...|:||..||..|:.|..|.||:|:|:||...:       |:..:.|:.:..: .
Zfish   190 GTGLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE-------YRGVMHCLSETAK-L 246

  Fly   297 GVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEG 331
            |.|..||||:|...||.|.::|.::.:|||:::.|
Zfish   247 GPLAFYKGLVPAGIRLIPHTILTFVFLEQLKKYFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/84 (25%)
Mito_carr 137..232 CDD:278578 25/96 (26%)
Mito_carr 237..329 CDD:278578 30/91 (33%)
slc25a10bNP_957466.1 PTZ00169 12..278 CDD:240302 80/290 (28%)
Mito_carr 12..92 CDD:278578 21/80 (26%)
Mito_carr <118..190 CDD:278578 20/74 (27%)
Mito_carr 197..281 CDD:278578 30/91 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.