DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG7514

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:299 Identity:85/299 - (28%)
Similarity:141/299 - (47%) Gaps:36/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGF 101
            :.:|:|..:...|....|.|||:.|||||:    :..||:...:|.. |..:.:.||..:||.|.
  Fly    13 YMMYINGGLAGMLGTCIVQPLDLVKTRMQI----SATTGEYKSSFDC-LLKVFKNEGILALYNGL 72

  Fly   102 SAMVTRNFIFNSLRVVLY----DVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDI 162
            ||.:.|...:.:.|:..|    |.:|:.|       .....:..::|....||.......||.::
  Fly    73 SAGLMRQATYTTARMGFYQMEIDAYRKQF-------NAPPTVLASMGMGILAGAFGAMFGNPAEV 130

  Fly   163 VKVRMQTEGR-----RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGS 222
            ..:||.::.|     ||      ....::.|||.|.:..|:.::|||..|:..||.::....:.|
  Fly   131 ALIRMMSDNRLPPAERR------NYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLAS 189

  Fly   223 YDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLD 287
            |...|..|....   .||.|...::|.:||..::.|.|.|:.|:|:..|      |...||.::|
  Fly   190 YSQLKAAFSEYF---SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQ------KTAEYKGTMD 245

  Fly   288 CVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQL 326
            .:.|:.:.||:.:|:||..|...||||.:|..::.:|||
  Fly   246 VLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 25/78 (32%)
Mito_carr 137..232 CDD:278578 25/99 (25%)
Mito_carr 237..329 CDD:278578 31/90 (34%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 85/296 (29%)
Mito_carr 19..90 CDD:278578 23/75 (31%)
Mito_carr 104..201 CDD:278578 25/102 (25%)
Mito_carr 207..284 CDD:278578 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.