DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a34

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_006539059.1 Gene:Slc25a34 / 384071 MGIID:2686215 Length:333 Species:Mus musculus


Alignment Length:336 Identity:92/336 - (27%)
Similarity:156/336 - (46%) Gaps:46/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PT--NVADPLTARNLFQLYVNTFIGAN-LAESCVF--PLDVAKTRMQVDGE-QAKKT-GKAMPTF 81
            ||  .:|..:.:|.:....|:..:||: ...:|||  ||:|.|||:|:.|| ||..| .:....|
Mouse     3 PTQAQMAPAMDSREMVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTYPRPYRGF 67

  Fly    82 RATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCS 146
            .:::..:.|.:|...|..|.:|.:....:.|.:|...|.:..:..|.|..            |.:
Mouse    68 VSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQP------------GGT 120

  Fly   147 FTAGCIAQALAN---------PFDI----------VKVRMQTEG-RRRQLGYDVRVNSMVQAFVD 191
            ..||..|.||..         |..|          ||.::|.:. ....:|:..:...::.|...
Mouse   121 VVAGAAAGALGAFVGSPAYLFPGSILELPSALNLQVKTQLQAQTVATMAVGHQHQHQGVLSALET 185

  Fly   192 IYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFK-RLLDLEEGLPLRFVSSMCAGLTAS 255
            |:|:.|:..:|:|||.:..|..:.:...:.::..:|...: |...||:...:.....|.:.:...
Mouse   186 IWRQQGMLGLWRGVGGAVPRVTVGSAAQLATFTSAKAWVQDRQWFLEDSWLVTLAGGMISSIAVV 250

  Fly   256 VLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVL-- 318
            .:.||.||:.:|:.|||||.:|:...|....||:.|..::||.|.|||||.|.:.||||.::|  
Mouse   251 AVMTPLDVVSTRLYNQPVDRAGRGQLYGGLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSM 315

  Fly   319 -FWLSVEQLRQ 328
             ||   ::||:
Mouse   316 FFW---DELRK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/78 (31%)
Mito_carr 137..232 CDD:278578 22/115 (19%)
Mito_carr 237..329 CDD:278578 35/95 (37%)
Slc25a34XP_006539059.1 Mito_carr 18..105 CDD:365909 26/86 (30%)
Mito_carr <156..226 CDD:365909 14/69 (20%)
Mito_carr 234..324 CDD:365909 34/93 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.