DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Shawn

DIOPT Version :10

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:232 Identity:53/232 - (22%)
Similarity:97/232 - (41%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MALGCSFTAGCIAQALANPFDIVKVRMQTEGRRR-----------------QLGYDV-------- 180
            :|..|  |...:......|.|::|.|:|.:.:..                 ..|.|.        
  Fly    43 VASAC--TGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKP 105

  Fly   181 --RVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFK-RLLDLEEGL-- 240
              |.:..:.||:.|.|..|:.|:|.|:.|:.:.|...|.    .|.::...|| |..|:....  
  Fly   106 APRFSGTIDAFIKISRTEGIGSLWSGLSPTLISALPSTI----IYFVAYEQFKARFTDIHYKYTR 166

  Fly   241 -----------PLRFVSSMCAGLTASVLS----TPADVIKSRMMNQPVDESGKNLYYKNSLDCVR 290
                       |:.|:..:.||::..:|:    :|.::|:::|.:|       .:.:......:|
  Fly   167 RPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQ-------RMTHAEMFGTIR 224

  Fly   291 KLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLR 327
            ::|:.:|||.|::||.||..|..|||.::|...|.|:
  Fly   225 QVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:395101
Mito_carr 137..232 CDD:395101 25/118 (21%)
Mito_carr 237..329 CDD:395101 26/108 (24%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:395101 26/121 (21%)
Mito_carr 178..265 CDD:395101 26/91 (29%)
Mito_carr 268..371 CDD:395101
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.