DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Shawn

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:330 Identity:71/330 - (21%)
Similarity:117/330 - (35%) Gaps:121/330 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EPRF---PPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPT 80
            :|||   |...||...|             ||.:....:.||||.|||:|...:           
  Fly    32 DPRFRIRPLQQVASACT-------------GAMVTACFMTPLDVIKTRLQAQQQ----------- 72

  Fly    81 FRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGC 145
              |.|:|                                    :.|||.|...:.:        |
  Fly    73 --ALLSN------------------------------------KCFLYCNGLMDHI--------C 91

  Fly   146 SFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCM 210
            .........|.|.|..                   |.:..:.||:.|.|..|:.|:|.|:.|:.:
  Fly    92 PCGPDTPNPAAAKPAP-------------------RFSGTIDAFIKISRTEGIGSLWSGLSPTLI 137

  Fly   211 RACLMTTGDVGSYDISKRTFK-RLLDLEEGL-------------PLRFVSSMCAGLTASVLS--- 258
            .|...|.    .|.::...|| |..|:....             |:.|:..:.||::..:|:   
  Fly   138 SALPSTI----IYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTC 198

  Fly   259 -TPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLS 322
             :|.::|:::|.:|       .:.:......:|::|:.:|||.|::||.||..|..|||.::|..
  Fly   199 VSPVELIRTKMQSQ-------RMTHAEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTC 256

  Fly   323 VEQLR 327
            .|.|:
  Fly   257 YEYLK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 11/74 (15%)
Mito_carr 137..232 CDD:278578 19/95 (20%)
Mito_carr 237..329 CDD:278578 26/108 (24%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 41/212 (19%)
Mito_carr 178..265 CDD:278578 26/91 (29%)
Mito_carr 268..371 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.