DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and sea

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:281 Identity:74/281 - (26%)
Similarity:120/281 - (42%) Gaps:53/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ESCV-FPLDVAKTRMQVDGE-QAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNS 113
            |.|: :|.:..||::|:|.: .|||........:.|    :...||..||.|.|.:|..:...::
  Fly    47 EICITYPTEYVKTQLQLDEKGAAKKYNGIFDCVKKT----VGERGFLGLYRGLSVLVYGSIPKSA 107

  Fly   114 LRVVLYDVFRRPFLYQN---ERNEEVLKIYMALGCSFTAG-CIAQALANPFDIVKVRM---QTEG 171
            .|...::     ||..|   .|.:  |.....|.|...|| |.|.....|.:.:||:.   |..|
  Fly   108 ARFGAFE-----FLKSNAVDSRGQ--LSNSGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSG 165

  Fly   172 RRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYD-ISKRTFKRLLD 235
            ..:..|:...|..::::       .|:..::||:.|:.::.        ||.. |.....:.|.|
  Fly   166 NPKFRGFAHGVGQIIKS-------EGISGIYKGLTPTILKQ--------GSNQAIRFFVLESLKD 215

  Fly   236 LEEG------LPLRFVS--SMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKL 292
            |.:|      :|...|.  ...||..:...:||.||:|:||...   |:.|   |||:..|..::
  Fly   216 LYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGL---EASK---YKNTAHCAVEI 274

  Fly   293 VREEGVLTLYKGLMPTWFRLG 313
            ::.||....|||.:|   |||
  Fly   275 LKNEGPAAFYKGTVP---RLG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 19/74 (26%)
Mito_carr 137..232 CDD:278578 21/99 (21%)
Mito_carr 237..329 CDD:278578 27/85 (32%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 74/281 (26%)
Mito_carr 34..117 CDD:278578 20/78 (26%)
Mito_carr 125..220 CDD:278578 24/111 (22%)
Mito_carr 235..314 CDD:278578 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.