DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG18327

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:283 Identity:87/283 - (30%)
Similarity:144/283 - (50%) Gaps:23/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLDVAKTRMQVDGEQAKKTGKAMP---TFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVV 117
            |::|.|||:|:.||.|.:...|.|   .|:|.:| :.:.:|...|..|.:..:...|:.||.|:.
  Fly    22 PVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVT-VAKNDGILGLQKGLAPALCFQFVINSFRLS 85

  Fly   118 LY-DVFRRPFLYQNERNEEVLK--IYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRR-QLGY 178
            :| ....:.:::.|:......|  .:.|||     |.:....|:||.::|.::|.:..:: .:||
  Fly    86 IYTHAVEKGWVHNNKGEISFAKGMFWGALG-----GVVGSYCASPFFLIKTQLQAQAAKQIAVGY 145

  Fly   179 DVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLP-- 241
            ..:..||..|...|||:.|:..:|:|...:..||.:.:...:..:..:|...|     |.|:.  
  Fly   146 QHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLK-----ENGVVTH 205

  Fly   242 ---LRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYK 303
               |.|.|.:.||...|:..||.||:.:|:.||.||..|:.:||:..||||..::|.|||..|||
  Fly   206 PTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYK 270

  Fly   304 GLMPTWFRLGPFSVLFWLSVEQL 326
            |..|.:.|..|:|.|..|..::|
  Fly   271 GFWPIYLRSAPYSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/71 (31%)
Mito_carr 137..232 CDD:278578 24/97 (25%)
Mito_carr 237..329 CDD:278578 39/95 (41%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 21/65 (32%)
PTZ00169 5..293 CDD:240302 86/281 (31%)
Mito_carr 101..201 CDD:278578 26/109 (24%)
Mito_carr 204..296 CDD:278578 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441276
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.