DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG8323

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:277 Identity:84/277 - (30%)
Similarity:139/277 - (50%) Gaps:11/277 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSLYAGFSAMVTRNFIFNSLRVV 117
            |::|.|||:|:.||.|.: |..:..::..:...|.|   :|...|..|.:..:...||.||.|:.
  Fly    22 PIEVIKTRIQLQGELAAR-GTYVEPYKGIVNAFITVAKNDGITGLQKGLAPALYFQFIINSFRLS 85

  Fly   118 LY-DVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRR-QLGYDV 180
            :| :...|.::: |.:.|  :...|.|......|.:....::||.::|.::|::..:: .:||..
  Fly    86 IYSEAMERRWMH-NRKGE--VSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQSQAAKQIAVGYQH 147

  Fly   181 RVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLR-F 244
            ...||..|...||.|.|:..:|:|...:..||.|.:...:.::..:|....: .||.....|. |
  Fly   148 AHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQ-YDLVTQPTLNSF 211

  Fly   245 VSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTW 309
            .:.:.||...||..||.|||.:|:.||.||..|:.|.|:..|||..|::|.|||..:|||....:
  Fly   212 SAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEGVYGMYKGFWANY 276

  Fly   310 FRLGPFSVLFWLSVEQL 326
            .|:.|.|.|..|..::|
  Fly   277 LRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/71 (30%)
Mito_carr 137..232 CDD:278578 22/95 (23%)
Mito_carr 237..329 CDD:278578 36/91 (40%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 20/65 (31%)
PTZ00169 5..293 CDD:240302 83/275 (30%)
Mito_carr 101..200 CDD:278578 23/101 (23%)
Mito_carr 206..301 CDD:278578 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441279
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.