DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a30

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:282 Identity:91/282 - (32%)
Similarity:156/282 - (55%) Gaps:15/282 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSLYAGFSAMVTRNFIF 111
            ||...||:|:.|||:|:.|:......:.: .:|..|..::|:   ||.::||:|.:..:.|...:
  Rat    19 AECGTFPIDLTKTRLQIQGQTNDAKFREI-RYRGMLHALMRIGREEGLRALYSGIAPAMLRQASY 82

  Fly   112 NSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQL 176
            .::::..|...:|  |......:|.|.|.:.  |...:|.|:.|:|||.|::|:|||.:....|.
  Rat    83 GTIKIGTYQSLKR--LAVERPEDETLLINVV--CGILSGVISSAIANPTDVLKIRMQAQNSAVQG 143

  Fly   177 GYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLP 241
            |       |:..|:.||::.|...:||||..:..||.::...::..|||:|:.......:.:.:.
  Rat   144 G-------MIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVS 201

  Fly   242 LRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLM 306
            ..|:||...||..::.|.|.||:::|||||.....|:...||.:|||:.:..:.||...||||..
  Rat   202 THFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQTWKNEGFFALYKGFW 266

  Fly   307 PTWFRLGPFSVLFWLSVEQLRQ 328
            |.|.||||::::|:|:.|||::
  Rat   267 PNWLRLGPWNIIFFLTYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 20/76 (26%)
Mito_carr 137..232 CDD:278578 31/94 (33%)
Mito_carr 237..329 CDD:278578 37/92 (40%)
Slc25a30NP_001013205.1 Solcar 1 7..96 21/79 (27%)
PTZ00169 9..289 CDD:240302 91/282 (32%)
Solcar 2 104..189 32/93 (34%)
Solcar 3 198..289 37/91 (41%)
Mito_carr 199..289 CDD:395101 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103926
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.