DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG8026

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:308 Identity:73/308 - (23%)
Similarity:128/308 - (41%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GANLAESCVFPLDVAKTRMQV-DGEQAKKTGKAMPTFR---ATLTNMIRVEGFKSLYAGFSAMVT 106
            |..::...:.|||:.|.|..| ||..|     .:|.:|   :..|.:.|.|||:.||.|    ||
  Fly    32 GGVVSTLILHPLDLIKIRFAVNDGRTA-----TVPQYRGLSSAFTTIFRQEGFRGLYKG----VT 87

  Fly   107 RNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIY-------MALG------CSFTAGCIAQALAN 158
            .|...:.....||      |::.|     .:|.:       |.||      .:..:|.:...|.|
  Fly    88 PNVWGSGSSWGLY------FMFYN-----TIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTN 141

  Fly   159 PFDIVKVR--MQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVG 221
            |..:||.|  :|.:.     ........|:.|...||:..|:..:::|..|..:.   ::.|.:.
  Fly   142 PIWVVKTRLCLQCDA-----ASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLG---VSHGAIQ 198

  Fly   222 --SYDISKRTFK--RLLDLEEGLP----LRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGK 278
              :|:..|..:.  |.|.::..|.    |.|.:  .:.|.|:..:.|..|:::|:.:.       
  Fly   199 FMTYEELKNAYNEYRKLPIDTKLATTEYLAFAA--VSKLIAAAATYPYQVVRARLQDH------- 254

  Fly   279 NLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQL 326
            :..|..:.||:::..|.||....||||..:..|:.|..::.:|..|.:
  Fly   255 HHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/78 (31%)
Mito_carr 137..232 CDD:278578 22/113 (19%)
Mito_carr 237..329 CDD:278578 22/94 (23%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 69/291 (24%)
Mito_carr 23..115 CDD:278578 28/102 (27%)
Mito_carr 119..213 CDD:278578 20/101 (20%)
Mito_carr 220..307 CDD:278578 22/92 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.