DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Dic3

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:288 Identity:78/288 - (27%)
Similarity:130/288 - (45%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ANLAESCVFPLDVAKTRMQVDGEQAKKT-GKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFI 110
            |.:|.:...|:|:.|.::|...:..:|| |:       .|..:....|....|.|.||...|...
  Fly    19 AAIAVTGTHPIDLIKVQLQTQSQADRKTVGE-------ILKGIHERSGILGFYNGISASWFRQLT 76

  Fly   111 FNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQT-----E 170
            :.:.|..||:.        .:...:..|:...:..:..||.:...:..|.|:|.||:|.     |
  Fly    77 YTTTRFALYEA--------GKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPE 133

  Fly   171 GRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLD 235
            .:||...:      :......||:..|:.|:::|..|:..||.|:|.|...:||..|:..|....
  Fly   134 EKRRNYKH------VFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATG 192

  Fly   236 LEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMN-QPVDESGKNLYYKNSLDCVRKLVREEGVL 299
            ..||:||.|.:|..||..|.|::.|.||||:..|| ||.:.||....:.::        .::|.|
  Fly   193 AGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLST--------AKQGPL 249

  Fly   300 TLYKGLMPTWFRLGPFSVLFWLSVEQLR 327
            ..|||.:|...|:.|.:::.::..||.|
  Fly   250 AFYKGFIPALIRVSPNTIITFVLYEQAR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 18/75 (24%)
Mito_carr 137..232 CDD:278578 26/99 (26%)
Mito_carr 237..329 CDD:278578 32/92 (35%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 75/284 (26%)
Mito_carr 15..91 CDD:278578 19/86 (22%)
Mito_carr 93..187 CDD:278578 26/99 (26%)
Mito_carr 200..281 CDD:278578 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.