DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG4995

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:337 Identity:77/337 - (22%)
Similarity:131/337 - (38%) Gaps:61/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERDYWHLRSLEIEE------EPRFPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTR 63
            ::|.:..|..||.:      ...|.|..|.|          :|...:|.........|.|..|..
  Fly    13 DKDPYRKRGSEIGDIQLKATSETFSPKMVVD----------FVAGLLGGAAGVLVGHPFDTVKVH 67

  Fly    64 MQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLY 128
            :|.|..:..|.......||    .:::.:.|..||.|.|:.:....:.|:   :::.|:......
  Fly    68 LQTDDPRNPKYKGTFHCFR----TIVQRDKFIGLYRGISSPMGGIGLVNA---IVFGVYGNVQRL 125

  Fly   129 QNERNEEVLKIYMALGCSFTAGCIAQA----LANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAF 189
            .|:.|        :|...|.||.||..    :..|.::.|.|:|..   .|:...::....:...
  Fly   126 SNDPN--------SLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLS---TQVDSGIKFTGPIHCL 179

  Fly   190 VDIYRRGGLPSMWKGVGPSCMRACLMTTGDV---GSYDISKRTFKRLLDLEE--GLPLRFVSSMC 249
            ..|.:..|:...:||:..:.:|       |:   .||.:|   |:.|:...|  |:....::..|
  Fly   180 KYIVKTEGIRGAFKGLTATILR-------DIPGFASYFVS---FEYLMRQVETPGVAYTLMAGGC 234

  Fly   250 AGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGP 314
            ||:::.:...|.||:|:.|.   .|..|.|..|...:||..|..|.||....::||..|..|..|
  Fly   235 AGMSSWLACYPIDVVKTHMQ---ADALGANAKYNGFIDCAMKGFRNEGPQYFFRGLNSTLIRAFP 296

  Fly   315 -----FSVLFWL 321
                 |.|:.|:
  Fly   297 MNAACFFVVSWV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 15/74 (20%)
Mito_carr 137..232 CDD:278578 21/101 (21%)
Mito_carr 237..329 CDD:278578 28/92 (30%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 21/105 (20%)
PTZ00169 41..295 CDD:240302 67/294 (23%)
Mito_carr 128..218 CDD:278578 23/110 (21%)
Mito_carr 221..304 CDD:278578 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.