DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and colt

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:134/308 - (43%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VNTFIGANLAESC----VFPLDVAKTRMQ-----VDGEQAKKTGKAMPTFRATL---TNMIRVEG 93
            |.:|:.......|    ..|||..|.|:|     ..|||        |.:|.|.   ...|:.||
  Fly    16 VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQ--------PLYRGTFDCAAKTIKNEG 72

  Fly    94 FKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIY--MALGCSFTAGCIAQAL 156
            .:.||.|.||.:|......::....|.:.:|    ..:|.|:....|  :.:..|| :|..:..:
  Fly    73 VRGLYKGMSAPLTGVAPIFAMCFAGYALGKR----LQQRGEDAKLTYPQIFVAGSF-SGLFSTLI 132

  Fly   157 ANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVG 221
            ..|.:.:||.:||:   :..|.:.:.|.|:.....:|:.|||.|::||       :|.....|:.
  Fly   133 MAPGERIKVLLQTQ---QGQGGERKYNGMIDCAGKLYKEGGLRSVFKG-------SCATMLRDLP 187

  Fly   222 SYDISKRTFKRLLDL-----EEGLPLRFVSSMCAGLTAS----VLSTPADVIKSRMMNQPVDESG 277
            :..:....::.|.|:     |.| .:...|::.||..|.    :|..||||:|||:.:.|...  
  Fly   188 ANGLYFLVYEALQDVAKSKSETG-QISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGT-- 249

  Fly   278 KNLYYKNSLDCVRK-LVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVE 324
                ||:.:..|.| |:.::|.|.||:|:.|...|..|.:...:..:|
  Fly   250 ----YKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 23/86 (27%)
Mito_carr 137..232 CDD:278578 21/96 (22%)
Mito_carr 237..329 CDD:278578 29/93 (31%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/102 (25%)
Mito_carr 112..202 CDD:395101 22/100 (22%)
Mito_carr 210..299 CDD:395101 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.