DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Ucp4A

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:337 Identity:125/337 - (37%)
Similarity:198/337 - (58%) Gaps:21/337 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EEEPRFPPTNVADPLTARNLFQL--------------YVNTFIGANLAESCVFPLDVAKTRMQVD 67
            |..|....:..::|..:....||              |:.:.:.|::||...:|||:.|||:|:.
  Fly     7 ESSPAVASSTSSNPAPSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTRLQIQ 71

  Fly    68 GE-QAKKTGKAMPTFR---ATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLY 128
            || .|...||:...:|   ||...:.|.||...|:.|.:..:.|:.:::.:|:..||:.|:.|  
  Fly    72 GEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEF-- 134

  Fly   129 QNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIY 193
             .:...:.|.::.:..|..|||.:||.||:|.|:|||::|.|||||.:|...||:|...||..|.
  Fly   135 -TQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIV 198

  Fly   194 RRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLS 258
            :|||:..:|||..|:..||.|:..||:.:||..|......|.:.:...:..::|:|||..|:::.
  Fly   199 QRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMG 263

  Fly   259 TPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSV 323
            |||||:|:|:||||.||:|:.|.|:.|:||:|:.|.:||.:.||||.:|.|.|:.|:|:.||||.
  Fly   264 TPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSF 328

  Fly   324 EQLRQWEGQSGF 335
            ||:|:..|.||:
  Fly   329 EQIRKMIGASGY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 26/78 (33%)
Mito_carr 137..232 CDD:278578 42/94 (45%)
Mito_carr 237..329 CDD:278578 44/91 (48%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 117/298 (39%)
Mito_carr 39..138 CDD:278578 30/101 (30%)
Mito_carr 142..239 CDD:278578 42/96 (44%)
Mito_carr 248..336 CDD:278578 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468823
Domainoid 1 1.000 92 1.000 Domainoid score I2582
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.