DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and sesB

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:307 Identity:69/307 - (22%)
Similarity:131/307 - (42%) Gaps:38/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YVNTF----IGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSL 97
            :|..|    |.|.::::.|.|::..|..:||  :...|.......::..:...||:   :||.|.
  Fly    23 FVKDFAAGGISAAVSKTAVAPIERVKLLLQV--QHISKQISPDKQYKGMVDCFIRIPKEQGFSSF 85

  Fly    98 YAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMA-LGCSFTAGCIAQALANPFD 161
            :.|..|.|.|.|...:|.....|.:::.||...::|.:..:.:.. |.....||..:.....|.|
  Fly    86 WRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLD 150

  Fly   162 IVKVRMQTE----GRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGS 222
            ..:.|:..:    |:|...|       :......|::..|:..:::|.|.|.....:......|.
  Fly   151 FARTRLAADTGKGGQREFTG-------LGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGF 208

  Fly   223 YDISKRTFKRLLDLEEGLPLRFVSSMCAGL---TASVLSTPADVIKSRMMNQPVDESGK---NLY 281
            ||    |.:.:|...:..|: ::|...|.:   .|.::|.|.|.::.|||.|    ||:   .:.
  Fly   209 YD----TARGMLPDPKNTPI-YISWAIAQVVTTVAGIVSYPFDTVRRRMMMQ----SGRKATEVI 264

  Fly   282 YKNSLDCVRKLVREEGVLTLYKGLMPTWFR--LGPFSVLFWLSVEQL 326
            |||:|.|...:.::||....:||......|  .|.|.::.:..::::
  Fly   265 YKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAFVLVLYDEIKKV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 18/77 (23%)
Mito_carr 137..232 CDD:278578 18/99 (18%)
Mito_carr 237..329 CDD:278578 25/98 (26%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 23/94 (24%)
PTZ00169 23..312 CDD:240302 69/307 (22%)
Mito_carr 124..220 CDD:278578 19/106 (18%)
Mito_carr 223..312 CDD:278578 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441693
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.