DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and CG5254

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:311 Identity:82/311 - (26%)
Similarity:120/311 - (38%) Gaps:48/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RNLFQLYVNTFIGANLAESCVF-PLDVAKTRMQVDGEQAKKTGKAMPTFRA-----------TLT 86
            |..||:....  .|...|.|:. ||||.|||:|:....|       |...|           ...
  Fly    13 RAAFQVLAGG--SAGFLEVCIMQPLDVVKTRIQIQATPA-------PNAAALGEVHYNGVFDCFA 68

  Fly    87 NMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFR--RPFLYQNERNEEVLKIYMALGCSFTA 149
            .|.|.||..|.:.|....:...   ...|.:.:.||.  :|...........|...:|   ..||
  Fly    69 KMYRHEGISSYWKGIMPPILAE---TPKRAIKFLVFEQTKPLFQFGSPTPTPLTFSLA---GLTA 127

  Fly   150 GCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRG-GLPSMWKGVGPSCMRAC 213
            |.:.....|||::|||..|.:.:::.|........::|      :.| |...:.||:..:..|..
  Fly   128 GTLEAIAVNPFEVVKVAQQADRQKKMLSTFAVAKGIIQ------QDGLGFSGLNKGITATMGRNG 186

  Fly   214 LMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVL----STPADVIKSRMMN-QPV 273
            :......|.|    .:.|.::...:...|.|:..:..|..|..|    :.|.||.|||:.. |||
  Fly   187 VFNMVYFGFY----HSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPV 247

  Fly   274 DESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVE 324
            ....|   |:.:|..:..:.||||...|||||:|...||||...:..|..|
  Fly   248 PGQIK---YRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/88 (25%)
Mito_carr 137..232 CDD:278578 21/95 (22%)
Mito_carr 237..329 CDD:278578 33/93 (35%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 24/105 (23%)
PTZ00169 19..301 CDD:240302 79/305 (26%)
Mito_carr 122..207 CDD:278578 21/97 (22%)
Mito_carr 209..305 CDD:278578 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441699
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.