DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and oac1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_593169.1 Gene:oac1 / 2541790 PomBaseID:SPAC139.02c Length:320 Species:Schizosaccharomyces pombe


Alignment Length:317 Identity:85/317 - (26%)
Similarity:131/317 - (41%) Gaps:39/317 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LTARNLFQLY----VNTFIGANLAESC-----VFPLDVAKTRMQVDGEQA---------KKTGKA 77
            |.|.|..|:.    |:.|:...|| :|     ..|.:|.|||.|:.|:..         |..|:|
pombe    10 LPAHNPTQVKKLGPVSGFLSGGLA-ACGAVTLTNPFEVIKTRFQLQGQLTKLDPSKRIYKSVGQA 73

  Fly    78 MPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRP----FLYQNERNEEVLK 138
                   .:.:.|.||.:.|..|...........|..|:..|:..||.    ||...:.|:  |.
pombe    74 -------FSLIARHEGIRGLQRGLGTAYVYQICLNGCRLGFYEPIRRTLNTWFLDDPKGNK--LA 129

  Fly   139 IYMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWK 203
            |.:|.|..  :|.......:||.:||.|||:...:..:|.......:..||..|.:..|:..::.
pombe   130 INVASGAG--SGLCGALFGSPFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSRIIKENGVKGLFV 192

  Fly   204 GVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRM 268
            |...:.:|....::..:..|:.:||..:....||||:.....:|..:|..........|.:.:||
pombe   193 GADAAILRTVSGSSVQLPIYNWAKRMIEHYNLLEEGMIKHLTASAVSGFGVCCTMQIFDTVMTRM 257

  Fly   269 MNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQ 325
            .||    ..|.| |||.:||:.|.:|.||...||||......|:.|.::.....|||
pombe   258 YNQ----KNKEL-YKNPIDCILKTIRSEGFFALYKGFGAHLARIAPHTIFCLTFVEQ 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/88 (24%)
Mito_carr 137..232 CDD:278578 22/94 (23%)
Mito_carr 237..329 CDD:278578 30/89 (34%)
oac1NP_593169.1 PTZ00169 19..295 CDD:240302 76/292 (26%)
Mito_carr 19..117 CDD:278578 25/105 (24%)
Mito_carr 127..223 CDD:278578 22/99 (22%)
Mito_carr 226..316 CDD:278578 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.