DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and slc-25A10

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_509133.1 Gene:slc-25A10 / 180940 WormBaseID:WBGene00019656 Length:290 Species:Caenorhabditis elegans


Alignment Length:307 Identity:96/307 - (31%)
Similarity:142/307 - (46%) Gaps:34/307 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV 91
            :|:..|.| |.:.|.....|| :|..|..|||:.|.::     |.::.||.  |.......:.:.
 Worm     1 MAEDKTKR-LGRWYFGGVAGA-MAACCTHPLDLLKVQL-----QTQQQGKL--TIGQLSLKIYKN 56

  Fly    92 EGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYM-ALGCSFTAGCIAQA 155
            :|..:.|.|.||.|.|...:::.|..:|:..::..     ..::.|..|. ||...| ||.....
 Worm    57 DGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQL-----PQDQPLPFYQKALLAGF-AGACGGM 115

  Fly   156 LANPFDIVKVRMQTEGRRRQLGYDVRVN--SMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTG 218
            :..|.|:|.||||.:.:   |..:.|.|  ..:...|.|.|..|...|:.|...:..||.|||.|
 Worm   116 VGTPGDLVNVRMQNDSK---LPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIG 177

  Fly   219 DVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYK 283
            .:..||..|:|.......|:.|...|.||:.|...|:|::.|.||:|:||||....|      :|
 Worm   178 QLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKTRMMNAAPGE------FK 236

  Fly   284 NSLDC---VRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLR 327
            ..|||   ..||    |.:..:||.:|.|.||.|.:||.::..||||
 Worm   237 GILDCFMFTAKL----GPMGFFKGFIPAWARLAPHTVLTFIFFEQLR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 19/74 (26%)
Mito_carr 137..232 CDD:278578 33/97 (34%)
Mito_carr 237..329 CDD:278578 37/94 (39%)
slc-25A10NP_509133.1 PTZ00169 3..279 CDD:240302 93/303 (31%)
Mito_carr 15..91 CDD:278578 21/83 (25%)
Mito_carr 95..193 CDD:278578 33/101 (33%)
Mito_carr 214..283 CDD:278578 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.