DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and ucp-4

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:313 Identity:107/313 - (34%)
Similarity:174/313 - (55%) Gaps:16/313 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKS 96
            |.:.:...|..:...|.:||:..:|||:.|||:|:...:..|.|....|:     ::||.||..:
 Worm    19 TFKKIATKYFLSCTAALVAETVTYPLDITKTRLQIARNKFTKGGMVQVTY-----DIIRREGAMA 78

  Fly    97 LYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFD 161
            |:.|.:..:||::|:..:|:..|:..|  .|..|:..|:...::.::.|...:|.|||..|:|.|
 Worm    79 LWTGVAPAITRHYIYTGIRMGAYEQIR--LLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTD 141

  Fly   162 IVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDIS 226
            :|||:||.||.||.....:|.......|..:||..|...:|.|..|:|.||.|:...|:.:||..
 Worm   142 LVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSV 206

  Fly   227 KRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDE------SGKNLY---Y 282
            |.......:|::......|:|.||||.|:::|.|:||:|:|||:|...|      ..||.:   |
 Worm   207 KHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLY 271

  Fly   283 KNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEGQSGF 335
            |..:||..|:::.||..:||||.:|::.|:.|:|:.||:|.|::|:|.|.|.|
 Worm   272 KGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRKWTGASSF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 23/74 (31%)
Mito_carr 137..232 CDD:278578 33/94 (35%)
Mito_carr 237..329 CDD:278578 39/100 (39%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 101/303 (33%)
Mito_carr 22..111 CDD:278578 27/95 (28%)
Mito_carr 115..214 CDD:278578 33/98 (34%)
Mito_carr <240..318 CDD:278578 31/77 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166380
Domainoid 1 1.000 105 1.000 Domainoid score I4164
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.