DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and Slc25a10

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:288 Identity:79/288 - (27%)
Similarity:130/288 - (45%) Gaps:31/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESCVFPLDVAKTRMQVDGE-QAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNS 113
            |..|..|||:.|..:|...| :.:.||.|:        .::|.:||.:||.|.||.:.|...::.
  Rat    19 AACCTHPLDLLKVHLQTQQEVKLRMTGMAL--------QVVRTDGFLALYNGLSASLCRQMTYSL 75

  Fly   114 LRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQTE-----GRR 173
            .|..:|:..|.   |..:.::..|..|..:.....:|.....:..|.|:|.||||.:     .:|
  Rat    76 TRFAIYETMRD---YMTKDS
QGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLPLSQR 137

  Fly   174 RQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEE 238
            |...:      .:.....:.|..||..::.|...:..|..|:|.|.:..||.:|:.......|.:
  Rat   138 RNYSH------ALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLVL
STGYLSD 196

  Fly   239 GLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYK 303
            .:...|:||..||..|:.|..|.||:|:|:||...:       |:....|..:..: .|....:|
  Rat   197 NIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE-------YQGVFHCAVETAK-LGPQAFFK 253

  Fly   304 GLMPTWFRLGPFSVLFWLSVEQLRQWEG 331
            ||:|...||.|.:||.::.:||||:..|
  Rat   254 GLVPAGVRLVPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/74 (30%)
Mito_carr 137..232 CDD:278578 23/99 (23%)
Mito_carr 237..329 CDD:278578 30/91 (33%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 24/83 (29%)
Mito_carr 94..189 CDD:395101 23/100 (23%)
Mito_carr 197..283 CDD:395101 31/93 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.