DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and SLC25A10

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:187 Identity:48/187 - (25%)
Similarity:78/187 - (41%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AESCVFPLDVAKTRMQVDGE-QAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRNFIFNS 113
            |..|..|||:.|..:|...| :.:.||.|:        .::|.:|..:||:|.||.:.|...::.
Human    20 AACCTHPLDLLKVHLQTQQEVKLRMTGMAL--------RVVRTDGILALYSGLSASLCRQMTYSL 76

  Fly   114 LRVVLYDVFR----------RPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQ 168
            .|..:|:..|          .||      :|:||     ||.  .:|.....:..|.|:|.||||
Human    77 TRFAIYETVRDRVAKGS
QGPLPF------HEKVL-----LGS--VSGLAGGFVGTPADLVNVRMQ 128

  Fly   169 T-----EGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDV 220
            .     :|:||...:      .:.....:.|..||..::.|...:..|..|:|.|.:
Human   129 NDVKLPQGQRRNYAH------ALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 22/84 (26%)
Mito_carr 137..232 CDD:278578 22/89 (25%)
Mito_carr 237..329 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 22/80 (28%)
Mito_carr 95..179 CDD:278578 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.