DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and slc25a10a

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:XP_002661286.1 Gene:slc25a10a / 100332610 ZFINID:ZDB-GENE-131127-11 Length:288 Species:Danio rerio


Alignment Length:297 Identity:85/297 - (28%)
Similarity:136/297 - (45%) Gaps:39/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IGANLAESCVFPLDVAKTRMQVDGE-QAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMVTRN 108
            |.:..|..|..|||:.|..:|...| :.:.||.|:        .::|.:|..:||.|.||.:.|.
Zfish    14 IASCAAACCTHPLDLIKVHLQTQQEVKMRMTGMAV--------QVVRSDGVFALYNGLSASLCRQ 70

  Fly   109 FIFNSLRVVLYDVFRRPFLYQNERNEEVL-KIYMALGCSFTAGCIAQALANPFDIVKVRMQTEGR 172
            ..::..|..:|:..|.....||:...... ||.:|....||.|.|    ..|.|:|.||||.:.:
Zfish    71 MSYSMTRFAIYETVRDQIASQNQGPMPFYQKILLAAFGGFTGGFI----GTPADMVNVRMQNDMK 131

  Fly   173 -----RRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKR 232
                 ||...:      .:...:.:.:..|:..::.|...:..|..|:|.|.:..||.:|:....
Zfish   132 LPPVLRRNYAH------ALDGLLRVLKEEGIRKLFSGASMAASRGALVTVGQLSCYDQAKQLVLG 190

  Fly   233 LLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVR---KLVR 294
            ...:.:.:...||:|..||..|:||..|.||:|:|:||...:       |:..:.|:.   ||  
Zfish   191 TGLMTDNIFTHFVASFIAGGCATVLCQPMDVVKTRLMNSKGE-------YRGLIHCLSDTGKL-- 246

  Fly   295 EEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEG 331
              |....||||:|...||.|.:||.::.:||||.:.|
Zfish   247 --GPKAFYKGLVPAGIRLIPHTVLTFIFLEQLRLYFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/75 (28%)
Mito_carr 137..232 CDD:278578 25/100 (25%)
Mito_carr 237..329 CDD:278578 34/94 (36%)
slc25a10aXP_002661286.1 Mito_carr 12..86 CDD:278578 22/79 (28%)
Mito_carr 94..190 CDD:278578 25/105 (24%)
Mito_carr 195..281 CDD:278578 34/96 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.