DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4C and ucp1

DIOPT Version :9

Sequence 1:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:293 Identity:95/293 - (32%)
Similarity:156/293 - (53%) Gaps:21/293 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FIGANLAESCV-----FPLDVAKTRMQVDGE---QAKKTGKAMPTFRATLTNMIRVEGFKSLYAG 100
            ||.|..| :|:     ||||.||.|:|:.||   .....|........|::.:::.||.||||.|
 Frog    17 FIAAGTA-ACIADLFTFPLDTAKVRLQIQGETTGSGAANGIRYKGVFGTISTIVKTEGPKSLYNG 80

  Fly   101 FSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKV 165
            ..|.:.|...|.|:|:.|||..:  ..|.|.:.:..:...:..||  |.|.:|..:|.|.|:|||
 Frog    81 LVAGLQRQMSFASIRIGLYDTVK--LFYTNGKEKAGIGSRILAGC--TTGALAVTVAQPTDVVKV 141

  Fly   166 RMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTF 230
            |.|.:...:  |...|.|..:.|:..|.::.|:..:|||..|:..|..::...::.:||:.|...
 Frog   142 RFQAQANLQ--GVKRRYNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTELVTYDVIKENL 204

  Fly   231 KRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVRE 295
            .....:.:.||..|||:..||...:|:::|.||:|:|.||.|..:      ||::|:|...::.:
 Frog   205 LHYKLMTDNLPCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQ------YKSALNCAWTMITK 263

  Fly   296 EGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQ 328
            ||....|||.:|::.|||.::|:.::|.|||::
 Frog   264 EGPTAFYKGFVPSFLRLGSWNVVMFVSYEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 29/82 (35%)
Mito_carr 137..232 CDD:278578 27/94 (29%)
Mito_carr 237..329 CDD:278578 34/92 (37%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 34/95 (36%)
PTZ00169 14..299 CDD:240302 95/293 (32%)
Mito_carr 111..208 CDD:278578 27/100 (27%)
Mito_carr 211..302 CDD:278578 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.