DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13992 and YHL050C

DIOPT Version :9

Sequence 1:NP_001188703.1 Gene:CG13992 / 33831 FlyBaseID:FBgn0031756 Length:659 Species:Drosophila melanogaster
Sequence 2:NP_011813.1 Gene:YHL050C / 856335 SGDID:S000001042 Length:697 Species:Saccharomyces cerevisiae


Alignment Length:159 Identity:28/159 - (17%)
Similarity:54/159 - (33%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 LGMGMNPFGPFGALNPFNPFNRV-------LGAPAPAAPTQNGNFFQRVFKFNQDAASTSTTEAA 547
            |..|::.:       |...||.:       ||..|....:.|             ..:::||.|:
Yeast   190 LSRGLSSY-------PTRMFNLIKEKSKVPLGTNATTTASTN-------------VRTSATTTAS 234

  Fly   548 PTTEVQSERSGKLNF--SSSTPAPPSSEQPDTIVGDDHDSDEAEDSAEDFDKEDDTAMTTPLPAS 610
            ......:..:..:|.  |::|....:|....|.....:.|..|..:|......:.|...:...::
Yeast   235 INVRTSATTTASINVRTSATTTESTNSNTNATTTESTNSSTNATTTASTNSSTNATTTESTNASA 299

  Fly   611 EPDDSADTSGVPAIVSKATELLKPTEKRK 639
            :.|.:.|.:.........|::.|...|||
Yeast   300 KEDANKDGNAEDNRFHPVTDINKEPYKRK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13992NP_001188703.1 PLN03142 573..>642 CDD:215601 12/67 (18%)
YHL050CNP_011813.1 SrmB 3..>187 CDD:223587
P-loop_NTPase 6..164 CDD:304359
YccJ 494..>547 CDD:305078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CNHI
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.