powered by:
Protein Alignment CG13992 and YPR204W
DIOPT Version :9
Sequence 1: | NP_001188703.1 |
Gene: | CG13992 / 33831 |
FlyBaseID: | FBgn0031756 |
Length: | 659 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015530.1 |
Gene: | YPR204W / 856334 |
SGDID: | S000006408 |
Length: | 1032 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 34/69 - (49%) |
Gaps: | 9/69 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 535 NQDAASTSTTEA---APTTEVQSERSGKLNFSSSTPAPPSSEQPDTIVGDDHDSDEAEDSAEDFD 596
|.:|.:|.:|.: |.|||..:. |.|::|.|..:|....|.. :..::...||:.:|.:
Yeast 586 NTNATTTESTNSSTNATTTEGTNS-----NTSATTTASTNSSTNATTT-ESTNASAKEDANKDGN 644
Fly 597 KEDD 600
.||:
Yeast 645 AEDN 648
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13992 | NP_001188703.1 |
PLN03142 |
573..>642 |
CDD:215601 |
6/28 (21%) |
YPR204W | NP_015530.1 |
SrmB |
3..453 |
CDD:223587 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CNHI |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.