powered by:
Protein Alignment CG13992 and YRF1-8
DIOPT Version :9
Sequence 1: | NP_001188703.1 |
Gene: | CG13992 / 33831 |
FlyBaseID: | FBgn0031756 |
Length: | 659 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_061495.4 |
Gene: | YRF1-8 / 854577 |
SGDID: | S000007526 |
Length: | 1796 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 107 |
Identity: | 25/107 - (23%) |
Similarity: | 42/107 - (39%) |
Gaps: | 16/107 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 535 NQDAASTSTTEAAPTTEVQSERSGKLNFSSSTPAPPSSEQPDTIVGDDHDSDEA--EDSAEDFDK 597
|.:.::|:|......|...:..|...|.|::|.|..:|....|.....:.|..| .:|.....|
Yeast 1335 NSNTSATTTESTDSNTSATTTESTDSNTSATTTASTNSSTNATTTASTNSSTNATTTESTNASAK 1399
Fly 598 EDDTAMTTPLPASEPDDSADTSGVPAIVSKATELLKPTEKRK 639
|| |::..::.|....| .|::.|.:.|||
Yeast 1400 ED---------ANKDGNAEDNRFHP-----VTDINKESYKRK 1427
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13992 | NP_001188703.1 |
PLN03142 |
573..>642 |
CDD:215601 |
15/69 (22%) |
YRF1-8 | NP_061495.4 |
Sir1 |
<13..88 |
CDD:402962 |
|
SrmB |
736..1225 |
CDD:223587 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CNHI |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.